TheTarotKnows

#tarot #predictions #chelsydavy PREDICTION: WILL CHELSY REACH OUT AND TAKE HARRY BACK? 24th July 2021 #shorts #thetarotknows Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #thecambridges #thequeen THE QUEEN GIFT'S WINDSOR CASTLE TO THE CAMBRIDGES?! MEGHAN MARKLE IS SEETHING WITH JEALOUSY! 😂 👹 #tarot Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #chelsydavy #meghanmarkle HARRY AND CHELSY MET AT ASPEN! ARE THEY JUST FRIENDS? Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #meghanmarkle #piersmorgan HOW DO MEGHAN MARKLE AND HARRY FEEL ABOUT PIERS MORGAN'S VICTORY? #thetarotknows #piersmorgan #ofcom Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #meghanmarkle #omidscobie HARRY AND MEGHAN SUING SCOBIE! WILL THE PALACE AIDS BULLYING CASE GO AHEAD? #thetarotknows #royalnews #palaceaids Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #harryandmeghan #princessdiana A MESSAGE FOR HARRY FROM HIS MOTHER, DIANA, PRINCESS OF WALES #thetarotknows #tarot #harry #diana

#thetarotknows #harryandmeghan #queen THE WORST! HOW DID HARRY AND MEGHAN MARKLE REALLY MEET? I'm truly gobsmacked! #thetarotknows #royalnews Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #harryandmeghanmontecito #princeharryandmeghanmarkle ARE HARRY AND MEGHAN MARKLE REALLY MOVING TO NEW YORK? WILL MEG GET INTO POLITICS? #thetarotknowsyoutube #thetarotknowslatest Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknowslatest #harryandmeghan #princesseugenie IS EUGENIE LEAKING INFO TO HARRY AND MEGHAN? THE YORKS ENERGY READING #lilytarot #theyorks #princeandrewtitles Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#tarot #thequeenlawyersup #meghanmarkle THE QUEEN LAWYERS UP! BUT WHY NOW? WILL SHE HAVE THE HARKLES CANCELLED? #thetarotknows #thequeen Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US Credit: Yankee Wally, Celt Views, Lady Colin Campbell DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #prediction #harrysmemoirs PREDICTED: HARRY'S BOOK RECORDED 25th July BEFORE THE QUEEN LAWYERED UP! #shorts WATCH FULL VIDEO: https://www.youtube.com/watch?v=K9km9mO4b9Y #thetarotknows Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#tarot #princeharryandmeghanmarkle #news HARRY AND MEGHAN: VIEWER QUESTIONS! SO SO MANY (as always)! #thetarotknows #windsorchristening #lili Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows PRINCE ANDREW LAWSUIT: WHO'S TELLING PORKIES? WILL VIRGINIA WIN? #tarot #royalnews Enjoy & thanks for watching, Lily x 🙏🔮 MY TEA JAR🍷😂: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #theroyalfamily #princeharryandmeghanmarklenetflix MEGHAN MARKLE AND PRINCE HARRY SAY THEY'RE WORKING WITH THE ROYAL FAMILY? 😂 BULLSH*T! 🙈🤡🤡😂💩 #shorts #thetarotknows #theroyalfamily #netflix Enjoy & thanks for watching, Lily x.🙏 TIP JAR: https://www.paypal.com/paypalme/toproyalmoments?locale.x=en_US DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #meghanmarkle #obamas READING MEGHAN MARKLE'S ENERGY ABOUT THE OBAMAS & HER 40TH BIRTHDAY VIDEO FAIL! #tarot #royalnews WARNING! DARK READING! Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #meghanmarkle #sarahferguson WHY DID MEGHAN MARKLE MENTION YACHTS IN HER VIDEO? DIGS AT THE YORKS & TRF! HARRY IS DUMPED! #tarot Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #meghanmarkle #harryandmeghan HARRY FUMING OVER LOSING RUGBY PATRONAGES! 🤬WERE HARRY AND MEGHAN BEHIND THE HBO CARTOON? #tarot Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#tarot #meghanmarkle #cambridgeday MEGHAN MARKLE'S BIRTHDAY FAIL! REJECTED BY OBAMAS, MOCKING THE QUEEN, CAMBRIDGE DAY & HAZ THE CLOWN! #royalnews Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

HAPPY CAMBRIDGE DAY! 👑 4TH AUGUST 😊 💕 #shorts #thetarotknows #royalnews #teamcambridge #tarot Thanks for watching! Enjoy, Lily xx

#tarot #princeharryandmeghanmarkle #royalnews "SIMPLE HARRY" OR DIRTY HARRY? #shorts #thetarotknows #tarotreading #psychic #tarot #meghanmarkle #psychopath THE STARE OF A JEALOUS DANGEROUS PSYCHOPATH: 'NUTMEG NARCLE' aka MEGHAN MARKLE #shorts #thetarotknows In my opinion.... Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading does not suffice under the circumstances. ​The Tarot Knows does not accept liability on any Tarot reading.

#thetarotknows #princeharry #meghanmarkle #Royal News: EX VET SAYS PRINCE HARRY IS "SIMPLE"! WHAT DIRTY SECRETS DO ARMY PALS HAVE ON THE XBOX SOLDIER? Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #lilibet #princeharryandmeghanmarkle LILIBET'S DNA - THOMAS & SCAM-ANTHA MARKLE - ARE THEY INVOLVED IN ALL OF THIS? #royalnews Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknows #plagiarism #tarotby HOW NOT TO READ TAROT (PARODY!) Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, parody and for entertainment purposes only. It can also be found on the public domain. Please do your own research and create your own content! TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. They are not necessarily true. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#tarot #princeharry #chelsydavy IS HARRY CHEATING WITH CHELSY? HOW DO HIS EXE'S FEEL ABOUT HIS BOOK? #thetarotknows #chelsyandharry July 24th #princeharryandmeghanmarklelatestnews Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.

#thetarotknowslatestyoutube #princeharrysbook #accident Royal News: SHOCKING CARDS! 😮HARRY'S BOOK OF ATTACK WILL BE STOPPED BY TRF! #tarot An accident in the cards! #lilytarot Enjoy & thanks for watching, Lily x.🙏 DISCLAIMER All of my content is alleged, in my personal opinion, and found on the public domain. Please do your own research. TAROT & PSYCHIC READINGS fall under the 'heading' of entertainment, are subject to interpretation, and should not be taken as absolute. ​It does not replace Professional Medical/Legal/Business advice on any occasion, regardless of how convinced you are that your reading is accurate. If you are suffering difficulties with health, mental health, legalities, or business concerns, you must consult with a qualified professional for treatment. A tarot reading, does not suffice under the circumstances. ​The Tarot Knows does not accept liability for advice given in any Tarot reading.