5 years agoMini-Truck (SE03 EP11) Redneck dump truck conversion, Mini gets a dumper (used parts)MotoCheez
1 year agoWhat is a Fall Flush? | Best Protein Source for Winter ChickensEdge of Nowhere FarmVerified
4 years ago5-Axis 3D Printing, Desktop Metal NYSE, Curiosity Rover, SpaceX, Boats, and More!Vision Miner 3D Printing
2 years agoThanks Ruthie For My New Cooler #Columbia #PFG #Cooler #AmazonWishList #Gift #mywalksinparadisemywalksinparadise
1 year agoBuyer Feedback: AIWUHE Kid's Full Body Swimwear Boys&Girls One Piece Swimsuit Long-Sleeve Water...Jaden Lory
1 year agoLive Stream Humorous Smart Shopping Advice for Sunday 20230709 Best Item vs Price Daily Big 5Silly and Fun with Judge WyldVerified
2 years ago2022 New MARS HYDRO TS600 100Watt LED Grow Light 2x2ft Coverage, New Diodes Layout Full Spectru...Your Home And Garden
3 years agoEverdale LIVE Gameplay! SuperSightLIVE! I'm back, let's go! 20 Mar 21! Supercell Game! iOS Tips! #11SuperSightVerified
3 years agoEverdale LIVE Gameplay! Eroda is alive! Reaching Level 9 village! SuperSightLIVE! 22 Mar 2021! #13SuperSightVerified