2 years ago#7 Nils Schuhmann vs. Jared Carstenn R1 HIGHLIGHTS - Royal Lahaina Challenger Wildcard 2014TennisNinjaTV
2 years agoRemember to follow me on Clapper just in case #Clapper #ClapperReferral #MWIP #BobSquadmywalksinparadise
1 year agoLivestream Highlights PT 3 - Gullible’s Island Beachwalk 4/1/2023 #FYP #AprilFools #BobSquadmywalksinparadise
2 years agoThanks Ruthie For My New Cooler #Columbia #PFG #Cooler #AmazonWishList #Gift #mywalksinparadisemywalksinparadise
4 months agoMel K & Cathy O’Brien | Haiti Revisited: The Clinton Haiti Connection | 11-15-24The Mel K ShowVerified
2 years agoEpisode 1 - PATENTED: How the Patented Spike Protein Was Designed to Infiltrate Your DNA - Absolute HealingHealthTube
4 months agoMel K & Helga Zepp-LaRouche | Ending the Zero-sum Game: Peaceful Coexistence is Possible | 11-16-24The Mel K ShowVerified